PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0808s0012.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 490aa    MW: 54718.1 Da    PI: 6.4556
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0808s0012.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.21.4e-083123491954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+ +++  LA+++gL+  qV++WF N R +
  Cagra.0808s0012.1.p 312 FEHflHPYPKDSDKIMLARQTGLSRGQVSNWFINARVR 349
                          554458******************************88 PP

2BELL125.91.5e-40174245172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          erqelq+k +kLls+l+eVd+ Ykqy++q+q+v+ssF+++ag+g+akpYtslAl++iSrhFrcL+dai++qi
  Cagra.0808s0012.1.p 174 ERQELQSKLSKLLSILDEVDRTYKQYYHQMQIVVSSFDVIAGCGAAKPYTSLALQTISRHFRCLRDAISGQI 245
                          79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.4E-68116243IPR006563POX domain
PfamPF075266.6E-45122242IPR006563POX domain
PROSITE profilePS5007111.564290353IPR001356Homeobox domain
SMARTSM003895.9E-9293357IPR001356Homeobox domain
CDDcd000862.59E-11293354No hitNo description
SuperFamilySSF466895.99E-17294360IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.9E-27296359IPR009057Homeodomain-like
PfamPF059209.1E-18310349IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MATYYKTGSS EIYSRPNVQD FVPGNAMVYT NSYSETFPRE STNIDVSASK EIQVLSSFGG  60
VSQQMVEVQD SGSWRDQEDN DRSCFPVMMR LGLSSQIETS RSNNNNEYAN ATQVVSGFTR  120
TIHNSKYLKA AQQLLDEAVN VKKALKQFQP EGDKIGEEKE KFLQTNVAEI PQAERQELQS  180
KLSKLLSILD EVDRTYKQYY HQMQIVVSSF DVIAGCGAAK PYTSLALQTI SRHFRCLRDA  240
ISGQILMIRK SLGGEHDGSD GRGVGISRLR NVDQQVRQQR TLQRLGVMQP HTWRPQRGLP  300
DSSVLVLRAW LFEHFLHPYP KDSDKIMLAR QTGLSRGQVS NWFINARVRL WKPMVEEMYK  360
EEFTDSLEEN DPNLSSENTP EITEIQEQQT ESSSNNGHVS GLASSSMGQS TVARGGAQFM  420
MVSDMTGNGS GGMSLTLGIQ NSDARGDVPM SGGIVHYENT ISGTDFQYLN SHNHQHRLGS  480
SKLLHDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-15299357563Homeobox protein Meis2
3k2a_B6e-15299357563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0567960.0AY056796.1 Arabidopsis thaliana At2g16400/F16F14.10 mRNA, complete cds.
GenBankBT0006090.0BT000609.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g16400/F16F14.10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297524.10.0hypothetical protein CARUB_v10013548mg
SwissprotQ9SIW10.0BLH7_ARATH; BEL1-like homeodomain protein 7
TrEMBLR0G4L10.0R0G4L1_9BRAS; Uncharacterized protein
STRINGAT2G16400.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28692563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.10.0BEL1-like homeodomain 7